PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400010437
Common NameLOC102603233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 409aa    MW: 46141.2 Da    PI: 9.3217
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400010437genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.14.4e-50311571128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                           + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk
  PGSC0003DMP400010437  31 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPdKSVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGK 118
                           579************************777.99***************777778899******************************** PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +++v+s +++ +g+k+tLvf++grapkg++t+W+mhey +
  PGSC0003DMP400010437 119 ERNVKS-SSNIIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 157
                           ******.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5626174IPR003441NAC domain
PROSITE profilePS5100554.23731175IPR003441NAC domain
PfamPF023651.5E-2633156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MENGHVSSSS RNERTPRNNN TEISIATASS MFPGFRFSPT DEELISYYLK KKLEGSDKCV  60
EVISEVEIWK HEPWDLPDKS VIQSDNEWFF FSPRGRKYPN GSQSKRATES GYWKATGKER  120
NVKSSSNIIG TKRTLVFHTG RAPKGQRTQW IMHEYCMIGN TNYQDSMVVC RLRKNSEFHL  180
NDTPRNQRNQ LVATESATAL SGAGQLGSLE LVNVGECCSK EGSSSFHSHS VEQIDSGSES  240
DKQTKEFSQH DSSGHFKDCD VEEDWFADIM KDDIIKLDDS SLNPRPISMI PDRPESSEIS  300
NHEAQAAMSS VVPFQGTANR RLRQVREIVM KCRVKGSKPY KAMKKNKVGV GATSSARWLR  360
NMLSVKWMRQ YVIPIFVATL IFLVMLLSLL GVSQQVKQRR HLLVLASS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-46221748164NAC domain-containing protein 19
4dul_A3e-46221748164NAC domain-containing protein 19
1ut7_B3e-46221748164NO APICAL MERISTEM PROTEIN
1ut7_A3e-46221748164NO APICAL MERISTEM PROTEIN
1ut4_B3e-46221748164NO APICAL MERISTEM PROTEIN
1ut4_A3e-46221748164NO APICAL MERISTEM PROTEIN
3swp_D4e-462217411167NAC domain-containing protein 19
3swp_C4e-462217411167NAC domain-containing protein 19
3swp_B4e-462217411167NAC domain-containing protein 19
3swp_A4e-462217411167NAC domain-containing protein 19
3swm_D4e-462217411167NAC domain-containing protein 19
3swm_C4e-462217411167NAC domain-containing protein 19
3swm_B4e-462217411167NAC domain-containing protein 19
3swm_A4e-462217411167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361089.10.0PREDICTED: NAC domain-containing protein 89-like isoform X1
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.14e-79NAC domain containing protein 89
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]